Recombinant Human SIGLEC6 Protein, Fc-tagged
Cat.No. : | SIGLEC6-446H |
Product Overview : | Recombinant human SIGLEC6 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 453 |
Description : | This gene encodes a member of the SIGLEC (sialic acid binding immunoglobulin-like lectin) family of proteins. The encoded transmembrane receptor binds sialyl-TN glycans and leptin. Placental expression of the encoded protein is upregulated in preeclampsia. |
Form : | Lyophilized |
Molecular Mass : | 60.3 kDa |
AA Sequence : | MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | SIGLEC6 sialic acid binding Ig-like lectin 6 [ Homo sapiens (human) ] |
Official Symbol | SIGLEC6 |
Synonyms | SIGLEC6; sialic acid binding Ig-like lectin 6; CD33L, CD33L1; sialic acid-binding Ig-like lectin 6; CD327; OB BP1; SIGLEC 6; CD33 antigen-like 1; obesity-binding protein 1; CD33L; OBBP1; CD33L1; CD33L2; CDW327; |
Gene ID | 946 |
mRNA Refseq | NM_001177547 |
Protein Refseq | NP_001171018 |
MIM | 604405 |
UniProt ID | O43699 |
◆ Recombinant Proteins | ||
SIGLEC6-55H | Recombinant Human SIGLEC6 Protein, Fc-His-tagged | +Inquiry |
SIGLEC6-446H | Recombinant Human SIGLEC6 Protein, Fc-tagged | +Inquiry |
SIGLEC6-0687H | Recombinant Human SIGLEC6 protein, Fc-tagged | +Inquiry |
SIGLEC6-339H | Recombinant Human SIGLEC6 protein, Fc-tagged | +Inquiry |
SIGLEC6-5344H | Recombinant Human SIGLEC6 Protein (Gln27-Ser331), C-Fc tagged | +Inquiry |
◆ Native Proteins | ||
SIGLEC6-13HB | Recombinant Human SIGLEC6 Protein, His&Avi tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGLEC6-795HCL | Recombinant Human SIGLEC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIGLEC6 Products
Required fields are marked with *
My Review for All SIGLEC6 Products
Required fields are marked with *
0
Inquiry Basket