"LIPF" Related Products

Expand
Expand

Recombinant Human LIPF, His-tagged

Cat.No.: LIPF-128H
Product Overview: Recombinant Human Gastric Triacylglycerol Lipase/LIPF is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu20-Lys398) of Human LIPF fused with a polyhistidine tag at the C-terminus.
Description: Gastric Triacylglycerol Lipase (LIPF) belongs to the AB hydrolase superfamily. LIPF is an important lipase during the digestion of dietary lipids in cystic fibrosis. LIPF is involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. LIPF is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. LIPF acts distinct roles in neutral lipid metabolism.
Source: HEK293
Species: Human
Tag: His
AA Sequence: LFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH GLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYD LPATIDFIVKKAGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSLINKL RFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYL SHNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDL LADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKKVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: LIPF lipase, gastric [ Homo sapiens ]
Official Symbol: LIPF
Synonyms: LIPF; lipase, gastric; gastric triacylglycerol lipase; HGL; HLAL; gastric lipase; GL; MGC138477; MGC142271;
Gene ID: 8513
mRNA Refseq: NM_001198828
Protein Refseq: NP_001185757
MIM: 601980
UniProt ID: P07098
Chromosome Location: 10q23
Pathway: Acylglycerol degradation, organism-specific biosystem; Acylglycerol degradation, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem;
Function: hydrolase activity; lipid binding; retinyl-palmitate esterase activity; triglyceride lipase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.