Recombinant Human LIPF, His-tagged
Cat.No. : | LIPF-128H |
Product Overview : | Recombinant Human Gastric Triacylglycerol Lipase/LIPF is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu20-Lys398) of Human LIPF fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-398 a.a. |
Description : | Gastric Triacylglycerol Lipase (LIPF) belongs to the AB hydrolase superfamily. LIPF is an important lipase during the digestion of dietary lipids in cystic fibrosis. LIPF is involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. LIPF is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. LIPF acts distinct roles in neutral lipid metabolism. |
AA Sequence : | LFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH GLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYD LPATIDFIVKKAGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSLINKL RFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYL SHNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDL LADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKKVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | LIPF lipase, gastric [ Homo sapiens ] |
Official Symbol | LIPF |
Synonyms | LIPF; lipase, gastric; gastric triacylglycerol lipase; HGL; HLAL; gastric lipase; GL; MGC138477; MGC142271; |
Gene ID | 8513 |
mRNA Refseq | NM_001198828 |
Protein Refseq | NP_001185757 |
MIM | 601980 |
UniProt ID | P07098 |
Chromosome Location | 10q23 |
Pathway | Acylglycerol degradation, organism-specific biosystem; Acylglycerol degradation, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; |
Function | hydrolase activity; lipid binding; retinyl-palmitate esterase activity; triglyceride lipase activity; |
◆ Recombinant Proteins | ||
LIPF-5220H | Recombinant Human LIPF Protein (Leu20-Lys398), N-GST tagged | +Inquiry |
LIPF-7939H | Recombinant Human LIPF protein, His & GST-tagged | +Inquiry |
LIPF-5099M | Recombinant Mouse LIPF Protein, His (Fc)-Avi-tagged | +Inquiry |
LIPF-292H | Recombinant Human LIPF, His-tagged | +Inquiry |
LIPF-101H | Recombinant Human LIPF, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPF-001HCL | Recombinant Human LIPF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIPF Products
Required fields are marked with *
My Review for All LIPF Products
Required fields are marked with *
0
Inquiry Basket