Recombinant Human LRRC3B, His-tagged LRRC3B-129H

Recombinant Human LRRC3B, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human LRRC3B, His-tagged

Recombinant Human LRRC3B, His-tagged

LRRC3B Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LRRC3B-129H
Product Overview : Recombinant Human Leucine-Rich Repeat-Containing Protein 3B/LRRC3B is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Cys34-Tyr204) of Human LRRC3B fused with a polyhistidine tag at the C-terminus.
Description : Leucine-Rich Repeat-Containing Protein 3B (LRRC3B) belongs to the LRRC3 family. LRRC3B is single-pass membrane protein and contains three leucine-rich repeats, one LRRCT domain, and one LRRNT domain. LRR-containing proteins, of which there are greater than 2,000, participate in many important processes, including plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis. A number of microarray expression profiling studies on human cancers have shown that LRRC3B is down-regulated in gastric, breast, colon, testis, prostate and brain cancers, suggesting LRRC3B involvement in carcinogenesis
Source : HEK293
Species : Human
Tag : His
AA Sequence : CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKN GIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASN HETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy