Recombinant Human LRRC3B Protein, GST-tagged
Cat.No. : | LRRC3B-4668H |
Product Overview : | Human LRRC3B full-length ORF ( NP_443185.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hypermethylation does not appear to be the cause of the reduced expression of this gene. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 55.7 kDa |
AA Sequence : | MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRC3B leucine rich repeat containing 3B [ Homo sapiens ] |
Official Symbol | LRRC3B |
Synonyms | LRP15; LRRC3B; leucine rich repeat containing 3B |
Gene ID | 116135 |
mRNA Refseq | NM_052953 |
Protein Refseq | NP_443185 |
UniProt ID | Q96PB8 |
◆ Recombinant Proteins | ||
LRRC3B-636H | Recombinant Human LRRC3B, GST-tagged | +Inquiry |
RFL13187MF | Recombinant Full Length Mouse Leucine-Rich Repeat-Containing Protein 3B(Lrrc3B) Protein, His-Tagged | +Inquiry |
LRRC3B-129H | Recombinant Human LRRC3B, His-tagged | +Inquiry |
LRRC3B-4303H | Recombinant Human LRRC3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LRRC3B-5965HF | Recombinant Full Length Human LRRC3B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC3B-4631HCL | Recombinant Human LRRC3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRC3B Products
Required fields are marked with *
My Review for All LRRC3B Products
Required fields are marked with *
0
Inquiry Basket