Recombinant Human LRRC3B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LRRC3B-4303H
Product Overview : LRRC3B MS Standard C13 and N15-labeled recombinant protein (NP_443185) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hypermethylation does not appear to be the cause of the reduced expression of this gene. Several transcript variants encoding the same protein have been found for this gene.
Molecular Mass : 29.3 kDa
AA Sequence : MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LRRC3B leucine rich repeat containing 3B [ Homo sapiens (human) ]
Official Symbol LRRC3B
Synonyms LRRC3B; leucine rich repeat containing 3B; LRP15; leucine-rich repeat-containing protein 3B; leucine-rich repeat protein 15; leucine-rich repeat protein LRP15
Gene ID 116135
mRNA Refseq NM_052953
Protein Refseq NP_443185
MIM 618996
UniProt ID Q96PB8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC3B Products

Required fields are marked with *

My Review for All LRRC3B Products

Required fields are marked with *

0
cart-icon
0
compare icon