"NAPEPLD" Related Products

Expand

Recombinant Human NAPEPLD, His-tagged

Cat.No.: NAPEPLD-152H
Product Overview: Recombinant Human N-Acyl-Phosphatidylethanolamine-Hydrolyzing Phospholipase D/NAPEPLD is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Phe393) of Human NAPEPLD fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
AA Sequence: MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKG KDGR FVNPWPTWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV REAGLRVT WLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDA VLISHNHYDHLD YNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPG HDKVTFVFTPSQHWCK RTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGP FDLAAIPIGAYEPRWFMKYQ HVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVK LNEALERYGLNAEDFFVLKHGESR YLNNDDENFVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: NAPEPLD N-acyl phosphatidylethanolamine phospholipase D [ Homo sapiens ]
Official Symbol: NAPEPLD
Synonyms: NAPEPLD; N-acyl phosphatidylethanolamine phospholipase D; N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D; C7orf18; chromosome 7 open reading frame 18; N acyl phosphatidylethanolamine hydrolyzing phospholipase D; FMP30; NAPE PLD; NAPE-hydrolyzing phospholipase D; NAPE-PLD; DKFZp781D1098;
Gene ID: 222236
mRNA Refseq: NM_001122838
Protein Refseq: NP_001116310
MIM: 612334
UniProt ID: Q6IQ20
Chromosome Location: 7q22.1
Pathway: Retrograde endocannabinoid signaling, organism-specific biosystem; Retrograde endocannabinoid signaling, conserved biosystem;
Function: NAPE-specific phospholipase D activity; hydrolase activity; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.