Recombinant Full Length Human NAPEPLD Protein, C-Flag-tagged
Cat.No. : | NAPEPLD-1799HFL |
Product Overview : | Recombinant Full Length Human NAPEPLD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.4 kDa |
AA Sequence : | MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWP TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMD ELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWF VPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFF FAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALA NEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNNDENF myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NAPEPLD N-acyl phosphatidylethanolamine phospholipase D [ Homo sapiens (human) ] |
Official Symbol | NAPEPLD |
Synonyms | FMP30; C7orf18; NAPE-PLD |
Gene ID | 222236 |
mRNA Refseq | NM_198990.6 |
Protein Refseq | NP_945341.3 |
MIM | 612334 |
UniProt ID | Q6IQ20 |
◆ Recombinant Proteins | ||
NAPEPLD-1324H | Recombinant Human NAPEPLD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NAPEPLD-1799HFL | Recombinant Full Length Human NAPEPLD Protein, C-Flag-tagged | +Inquiry |
NAPEPLD-2431C | Recombinant Chicken NAPEPLD | +Inquiry |
Napepld-003M | Recombinant Mouse Napepld Protein, Myc/DDK-tagged | +Inquiry |
Napepld-4292M | Recombinant Mouse Napepld Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAPEPLD-3971HCL | Recombinant Human NAPEPLD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAPEPLD Products
Required fields are marked with *
My Review for All NAPEPLD Products
Required fields are marked with *