"PDCD10" Related Products

Expand
Expand

Recombinant Human PDCD10 protein, T7-tagged

Cat.No. : PDCD10-170H
Product Overview : Recombinant human PDCD10 (212aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7
Form : 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGL TQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKD IASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTF KTVA
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name : PDCD10 programmed cell death 10 [ Homo sapiens ]
Official Symbol : PDCD10
Synonyms : PDCD10; programmed cell death 10; CCM3, cerebral cavernous malformations 3; programmed cell death protein 10; TFAR15; CCM3; MGC1212; MGC24477;
Gene ID : 11235
mRNA Refseq : NM_007217
Protein Refseq : NP_009148
MIM : 609118
UniProt ID : Q9BUL8
Chromosome Location : 3q26.1
Pathway : Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function : protein N-terminus binding; protein binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.