Recombinant Human PDCD10 protein, T7-tagged
| Cat.No. : | PDCD10-170H |
| Product Overview : | Recombinant human PDCD10 (212aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 212 a.a. |
| Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGEFGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGL TQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKD IASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTF KTVA |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | PDCD10 programmed cell death 10 [ Homo sapiens ] |
| Official Symbol | PDCD10 |
| Synonyms | PDCD10; programmed cell death 10; CCM3, cerebral cavernous malformations 3; programmed cell death protein 10; TFAR15; CCM3; MGC1212; MGC24477; |
| Gene ID | 11235 |
| mRNA Refseq | NM_007217 |
| Protein Refseq | NP_009148 |
| MIM | 609118 |
| UniProt ID | Q9BUL8 |
| Chromosome Location | 3q26.1 |
| Pathway | Validated targets of C-MYC transcriptional activation, organism-specific biosystem; |
| Function | protein N-terminus binding; protein binding; protein homodimerization activity; |
| ◆ Recombinant Proteins | ||
| PDCD10-3339R | Recombinant Rhesus monkey PDCD10 Protein, His-tagged | +Inquiry |
| PDCD10-12530M | Recombinant Mouse PDCD10 Protein | +Inquiry |
| Pdcd10-4731M | Recombinant Mouse Pdcd10 Protein, Myc/DDK-tagged | +Inquiry |
| PDCD10-6571M | Recombinant Mouse PDCD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PDCD10-151H | Recombinant Human PDCD10 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD10-3363HCL | Recombinant Human PDCD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD10 Products
Required fields are marked with *
My Review for All PDCD10 Products
Required fields are marked with *
