Recombinant Human PDCD10 protein, T7-tagged

• Cat.No.: PDCD10-170H
• Product Overview: Recombinant human PDCD10 (212aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 212 a.a.
• Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGL TQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKD IASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTF KTVA
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: PDCD10 programmed cell death 10 [ Homo sapiens ]
• Official Symbol: PDCD10
• Synonyms: PDCD10; programmed cell death 10; CCM3, cerebral cavernous malformations 3; programmed cell death protein 10; TFAR15; CCM3; MGC1212; MGC24477
• Gene ID: 11235
• mRNA Refseq: NM_007217
• Protein Refseq: NP_009148
• MIM: 609118
• UniProt ID: Q9BUL8
• Chromosome Location: 3q26.1
• Pathway: Validated targets of C-MYC transcriptional activation, organism-specific biosystem
• Function: protein N-terminus binding; protein binding; protein homodimerization activity