"Defb1" Related Products

Expand
Expand
Expand

Recombinant Rat Defb1 protein

Cat.No. : Defb1-596R
Product Overview : Recombinant Rat Defb1 protein was expressed in Escherichia coli.
Description : Defensins (alpha and beta) are cationic peptides with antimicrobial activity against Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses. They are 2-6 kDa proteins and take important roles in innate immune system. On the basis of their size and pattern of disulfide bonding, mammalian defensins are classified into alpha, beta and theta categories. β-Defensins are expressed on some leukocytes and at epithelial surfaces. They contain a six-cysteine motif that forms three intra-molecular disulfide bonds. Because β-defensins are cationic peptides, they can therefore interact with the membrane of invading microbes, which are negative due to lipopolysaccharides (LPS) and lipoteichoic acid (LTA) found in the cell membrane. Especially, they have higher affinity to the binding site compared to Ca2+ and Mg2+ ions. Furthermore, they can affect the stability of the membrane. Additionally, they are not only have the ability to strengthen the innate immune system but can also enhance the adaptive immune system by chemotaxis of monocytes, T-lymphocytes, dendritic cells and mast cells to the infection site.
Source : E.coli
Species : Rat
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, 500 mM NaCl, pH 7.0.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using CD34+ dendritic cells is in a concentration range of 100.0-1000.0 ng/ml.
Molecular Mass : Approximately 4.1 kDa, a single non-glycosylated polypeptide chain containing 37 amino acids.
Protein length : 37
AA Sequence : DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS
Endotoxin : Less than 1 EU/µg of rRtBD-1 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : Defb1
Official Symbol : Defb1
Synonyms : DEFB1; defensin beta 1; beta-defensin 1; BD-1; rBD-1;
Gene ID : 83687
mRNA Refseq : NM_031810
Protein Refseq : NP_113998
UniProt ID : O89117

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.