Recombinant Human CRH, GST-tagged
Cat.No. : | CRH-108H |
Product Overview : | Human CRH partial ORF ( AAH11031, 154 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Description : | Alpha-ketoglutarate-dependent dioxygenase FTO, also known as Fat mass and obesity-associated protein, FTO and KIAA1752, is a nucleus protein which belongs to the fto family. FTO is ubiquitously expressed, with relatively high expression in adrenal glands and brain; especially in hypothalamus and pituitary. FTO is a dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. FTO has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. It has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. FTO has no activity towards 1-methylguanine. It has no detectable activity towards double-stranded DNA. FTO requires molecular oxygen, alpha-ketoglutarate and iron. FTO contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. It contributes to the regulation of body size and body fat accumulation as well. Defects in FTO are the cause of growth retardation developmental delay coarse facies and early death. The disease consists of a severe children multiple congenital anomaly syndrome with death by the age of 3 years. All affected individuals had postnatal growth retardation, microcephaly, severe psychomotor delay, functional brain deficits, and characteristic facial dysmorphism. |
Source : | wheat germ |
Species : | Human |
Tag : | GST |
Form : | Liquid |
Molecular Mass : | 30.47 kDa |
AA Sequence : | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | CRH corticotropin releasing hormone [ Homo sapiens ] |
Official Symbol : | CRH |
Synonyms : | CRH; corticotropin releasing hormone; corticoliberin; corticotropin releasing factor; CRF; corticotropin-releasing factor; |
Gene ID : | 1392 |
mRNA Refseq : | NM_000756 |
Protein Refseq : | NP_000747 |
MIM : | 122560 |
UniProt ID : | P06850 |
Chromosome Location : | 8q13 |
Pathway : | Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Long-term depression, organism-specific biosystem; Long-term depression, conserved biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; |
Function : | corticotropin-releasing hormone activity; corticotropin-releasing hormone receptor 1 binding; corticotropin-releasing hormone receptor 2 binding; hormone activity; neuropeptide hormone activity; protein binding; receptor binding; |
Products Types
◆ Recombinant Protein | ||
CRH-1974M | Recombinant Mouse CRH Protein, His (Fc)-Avi-tagged | +Inquiry |
CRH-841H | Recombinant Human CRH Protein, His&GST-tagged | +Inquiry |
CRH-2730H | Recombinant Human CRH Protein, His (Fc)-Avi-tagged | +Inquiry |
CRH-1253R | Recombinant Rat CRH Protein, His (Fc)-Avi-tagged | +Inquiry |
CRH-7791H | Recombinant Human CRH protein, His & GST-tagged | +Inquiry |
◆ Lysates | ||
CRH-7281HCL | Recombinant Human CRH 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket