"PLA2G7" Related Products

Expand
Expand
Expand

Recombinant Human PLA2G7, GST-tagged

Cat.No.: PLA2G7-105H
Product Overview: Human PLA2G7 full-length ORF ( AAH38452.1, 22 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.
Source: in vitro wheat germ expression system
Species: Human
Tag: GST
Molecular Mass: 71.72 kDa
AA Sequence: FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTL WIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHG FIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVK NALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEY FQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHL GLHKDFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYN
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: PLA2G7 phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma) [ Homo sapiens (human) ]
Official Symbol: PLA2G7
Synonyms: PLA2G7; PAFAD; PAFAH; LP-PLA2; LDL-PLA2; phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma); platelet-activating factor acetylhydrolase; LDL-PLA(2); gVIIA-PLA2; PAF 2-acylhydrolase; PAF acetylhydrolase; group-VIIA phospholipase A2; LDL-associated phospholipase A2; lipoprotein-associated phospholipase A2; 1-alkyl-2-acetylglycerophosphocholine esterase; 2-acetyl-1-alkylglycerophosphocholine esterase; EC 3.1.1.47
Gene ID: 7941
mRNA Refseq: NM_001168357
Protein Refseq: NP_001161829
MIM: 601690
UniProt ID: Q13093
Chromosome Location: 6p21.2-p12
Pathway: Ether lipid metabolism; Lissencephaly gene (LIS1) in neuronal migration and development; Metabolism of proteins
Function: 1-alkyl-2-acetylglycerophosphocholine esterase activity; calcium-independent phospholipase A2 activity; phospholipid binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.