"FTO" Related Products

Expand
Expand

Recombinant Human FTO, GST-tagged

Cat.No.: FTO-118H
Product Overview: Human FTO full-length ORF ( AAH01284.1, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 41.8 kDa
AA Sequence: MGHPRAIQPSVFFSPYDVHFLLYPIRCPYLKIGRFHIKLKGLHFLFSFLFFFFETQSHSVTRLECSGTISAHCNL CLPGSSNSPASASQVAGTTGTCHHAQLIFVFLAEMGFHHIGQDGLDLNLVIHPPRSPKALGLQA
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: FTO fat mass and obesity associated [ Homo sapiens (human) ]
Official Symbol: FTO
Synonyms: FTO; ALKBH9; fat mass and obesity associated; alpha-ketoglutarate-dependent dioxygenase FTO; protein fto; AlkB homolog 9; fat mass and obesity-associated protein
Gene ID: 79068
mRNA Refseq: NM_001080432
Protein Refseq: NP_001073901
MIM: 610966
UniProt ID: Q9C0B1
Chromosome Location: 16q12.2
Function: DNA-N1-methyladenine dioxygenase activity; ferrous iron binding; oxidative DNA demethylase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.