"MDM2" Related Products

Expand
Expand
Expand

Recombinant Human MDM2, GST-tagged

Cat.No.: MDM2-1065H
Product Overview: Recombinant Human MDM2 (1 a.a. - 491 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 81.6 kDa
AA Sequence: MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIV YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSS HLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLD AGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCV EENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCI VHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MDM2 MDM2 oncogene, E3 ubiquitin protein ligase [ Homo sapiens (human) ]
Official Symbol: MDM2
Synonyms: MDM2; HDMX; hdm2; ACTFS; MDM2 oncogene, E3 ubiquitin protein ligase; E3 ubiquitin-protein ligase Mdm2; oncoprotein Mdm2; Mdm2, p53 E3 ubiquitin protein ligase homolog; double minute 2, human homolog of; p53-binding protein; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein
Gene ID: 4193
mRNA Refseq: NM_001145337
Protein Refseq: NP_001138809
MIM: 164785
UniProt ID: Q00987
Chromosome Location: 12q14.3-q15
Pathway: AKT phosphorylates targets in the cytosol; Aurora A signaling; Cell Cycle Checkpoints
Function: enzyme binding; identical protein binding; peroxisome proliferator activated receptor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.