"PARP12" Related Products

Recombinant Human PARP12, His-GST tagged

Cat.No.: PARP12-433H
Product Overview: Recombinant Human PARP12 (a.a. 500-701), fused with N-terminal His-GST tag, was expressed in a Baculovirus infected Sf9 cell expression system.
Description: Poly (ADP-ribose) polymerase (PARP) is a protein involved in a number of cellular processes involving mainly DNA repair and programmed cell death.
Source: Sf9 cell
Species: Human
Tag: His&GST
Form: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 8mM Glutathione, 0.04% Tween20, and 20% glycerol.
Molecular Mass: 51 kDa
AA Sequence: MHHHHHHGGGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLT QSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFKDRLCHKT YLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP PKSDPENLYFQGGGEFKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEVYQWQKGQMQKQNGGKAVD ERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGSYFARDAAYSHHYSKSDTQTHTMFLARVLVGEFVRGNAS FVRPPAKEGWSNAFYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLFSSRQ
Purity: ≥90%
Applications: Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Stability: >6 months at –80°C
Gene Name: PARP12 poly (ADP-ribose) polymerase family, member 12 [ Homo sapiens (human) ]
Official Symbol: PARP12
Synonyms: PARP12; ZC3H1; ARTD12; MST109; MSTP109; ZC3HDC1; poly [ADP-ribose] polymerase 12; zinc finger CCCH type domain containing 1; zinc finger CCCH domain-containing protein 1; ADP-ribosyltransferase diphtheria toxin-like 12; NP_073587.1; EC 2.4.2.30
Gene ID: 64761
mRNA Refseq: NM_022750
Protein Refseq: NP_073587
MIM: 612481
UniProt ID: Q9H0J9
Chromosome Location: 7q34
Function: NAD+ ADP-ribosyltransferase activity; metal ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.