Recombinant Human PARP12, His-GST tagged
| Cat.No. : | PARP12-433H |
| Product Overview : | Recombinant Human PARP12 (a.a. 500-701), fused with N-terminal His-GST tag, was expressed in a Baculovirus infected Sf9 cell expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Sf9 Cells |
| Tag : | GST&His |
| Protein Length : | 500-701 a.a. |
| Description : | Poly (ADP-ribose) polymerase (PARP) is a protein involved in a number of cellular processes involving mainly DNA repair and programmed cell death. |
| Form : | 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 8mM Glutathione, 0.04% Tween20, and 20% glycerol. |
| Molecular Mass : | 51 kDa |
| AA Sequence : | MHHHHHHGGGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLT QSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFKDRLCHKT YLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP PKSDPENLYFQGGGEFKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEVYQWQKGQMQKQNGGKAVD ERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGSYFARDAAYSHHYSKSDTQTHTMFLARVLVGEFVRGNAS FVRPPAKEGWSNAFYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLFSSRQ |
| Purity : | ≥90% |
| Applications : | Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. |
| Stability : | >6 months at –80°C |
| Gene Name | PARP12 poly (ADP-ribose) polymerase family, member 12 [ Homo sapiens (human) ] |
| Official Symbol | PARP12 |
| Synonyms | PARP12; ZC3H1; ARTD12; MST109; MSTP109; ZC3HDC1; poly [ADP-ribose] polymerase 12; zinc finger CCCH type domain containing 1; zinc finger CCCH domain-containing protein 1; ADP-ribosyltransferase diphtheria toxin-like 12; NP_073587.1; EC 2.4.2.30 |
| Gene ID | 64761 |
| mRNA Refseq | NM_022750 |
| Protein Refseq | NP_073587 |
| MIM | 612481 |
| UniProt ID | Q9H0J9 |
| Chromosome Location | 7q34 |
| Function | NAD+ ADP-ribosyltransferase activity; metal ion binding |
| ◆ Recombinant Proteins | ||
| PARP12-6503M | Recombinant Mouse PARP12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PARP12-5643H | Recombinant Human PARP12 protein, His&Myc-tagged | +Inquiry |
| PARP12-432H | Recombinant Human PARP12, GST-tagged | +Inquiry |
| PARP12-12370M | Recombinant Mouse PARP12 Protein | +Inquiry |
| PARP12-433H | Recombinant Human PARP12, His-GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARP12 Products
Required fields are marked with *
My Review for All PARP12 Products
Required fields are marked with *
