Recombinant Human ADAM17 ADAM17-593H

Recombinant Human ADAM17

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ADAM17

Recombinant Human ADAM17

ADAM17 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ADAM17-593H
Product Overview : Recombinant Human ADAM17 was expressed in Insect cells.
Description : This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme; binds mitotic arrest deficient 2 protein; and also plays a prominent role in the activation of the Notch signaling pathway.
Source : Insect cells
Species : Human
Form : Lyophilised
Bio-activity : Activity was tested using the synthetic peptide, Abz-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Dpa(Dnp)-NH2, as a substrate. Specific activity = 280 units/mg.
Molecular Mass : 62 kDa
Protein length : 215 to 651
AA Sequence : RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKS PQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAY VGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDP DGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGNSR VDEGEECDPGIMYLNNDTCCNS DCTLKEGVQC SDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDD TVCLDLGKCK DGKCIPFCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFL RKGKPCTVGF CDMNGKCEKRVQDVIER
Purity : >90% by SDS-PAGE.
Applications : Functional Studies; SDS-PAGE
Storage : Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
Reconstitution : Reconstitute with sterile deionized water at 0.1µg protein/µl. For long term storage, it is recommended to add a carrier protein (0.1% BSA). Avoid multiple freeze/thaw cycles.
Gene Name : ADAM17 ADAM metallopeptidase domain 17 [ Homo sapiens (human) ]
Official Symbol : ADAM17
Synonyms : ADAM17; CSVP; TACE; NISBD; ADAM18; CD156B; ADAM metallopeptidase domain 17; disintegrin and metalloproteinase domain-containing protein 17; TNF-alpha convertase; snake venom-like protease; TNF-alpha converting enzyme; ADAM metallopeptidase domain 18; tumor necrosis factor, alpha, converting enzyme; NP_003174.3; EC 3.4.24.86
Gene ID : 6868
mRNA Refseq : NM_003183
Protein Refseq : NP_003174
MIM : 603639
UniProt ID : P78536
Chromosome Location : 2p25
Pathway : Activated NOTCH1 Transmits Signal to the Nucleus; BDNF signaling pathway; Constitutive Signaling by NOTCH1 PEST Domain Mutants
Function : Notch binding; PDZ domain binding; interleukin-6 receptor binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy