"TUBB2A" Related Products

Expand
Expand

Recombinant Human TUBB2A, GST-tagged

Cat.No.: TUBB2A-105H
Product Overview: Recombinant Human TUBB2A (1 a.a. - 445 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Tubulin beta-2A chain is a protein that in humans is encoded by the TUBB2A gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 74.47 kDa
AA Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDS VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTL LISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDL NHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQ ELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: TUBB2A tubulin, beta 2A class IIa [ Homo sapiens (human) ]
Official Symbol: TUBB2A
Synonyms: TUBB2A; TUBB; TUBB2; dJ40E16.7; tubulin, beta 2A class Iia; tubulin beta-2A chain; class IIa beta-tubulin; tubulin beta class Iia; tubulin, beta polypeptide 2
Gene ID: 7280
mRNA Refseq: NM_001069
Protein Refseq: NP_001060
MIM: 615101
UniProt ID: Q13885
Chromosome Location: 6p25
Pathway: Chaperonin-mediated protein folding; Formation of tubulin folding intermediates by CCT/TriC; Metabolism of proteins
Function: GTP binding; GTPase activity; structural constituent of cytoskeleton

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.