Recombinant Human TUBB2A, GST-tagged
Cat.No. : | TUBB2A-105H |
Product Overview : | Recombinant Human TUBB2A (1 a.a. - 445 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Tubulin beta-2A chain is a protein that in humans is encoded by the TUBB2A gene. |
Molecular Mass : | 74.47 kDa |
AA Sequence : | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDS VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTL LISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDL NHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQ ELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TUBB2A tubulin, beta 2A class IIa [ Homo sapiens (human) ] |
Official Symbol | TUBB2A |
Synonyms | TUBB2A; TUBB; TUBB2; dJ40E16.7; tubulin, beta 2A class Iia; tubulin beta-2A chain; class IIa beta-tubulin; tubulin beta class Iia; tubulin, beta polypeptide 2 |
Gene ID | 7280 |
mRNA Refseq | NM_001069 |
Protein Refseq | NP_001060 |
MIM | 615101 |
UniProt ID | Q13885 |
Chromosome Location | 6p25 |
Pathway | Chaperonin-mediated protein folding; Formation of tubulin folding intermediates by CCT/TriC; Metabolism of proteins |
Function | GTP binding; GTPase activity; structural constituent of cytoskeleton |
◆ Recombinant Proteins | ||
TUBB2A-4260H | Recombinant Human TUBB2A Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBB2A-535HF | Recombinant Full Length Human TUBB2A Protein, GST-tagged | +Inquiry |
TUBB2A-9760M | Recombinant Mouse TUBB2A Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBB2A-1548H | Recombinant Human TUBB2A Protein (1-445 aa), His-tagged | +Inquiry |
TUBB2A-6361R | Recombinant Rat TUBB2A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBB2A-651HCL | Recombinant Human TUBB2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBB2A Products
Required fields are marked with *
My Review for All TUBB2A Products
Required fields are marked with *
0
Inquiry Basket