Recombinant Human TUBB2A, GST-tagged
| Cat.No. : | TUBB2A-105H | 
| Product Overview : | Recombinant Human TUBB2A (1 a.a. - 445 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | Tubulin beta-2A chain is a protein that in humans is encoded by the TUBB2A gene. | 
| Molecular Mass : | 74.47 kDa | 
| AA Sequence : | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDS VRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTL LISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDL NHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQ ELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA | 
| Applications : | ELISA; WB-Re; AP; Array | 
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | TUBB2A tubulin, beta 2A class IIa [ Homo sapiens (human) ] | 
| Official Symbol | TUBB2A | 
| Synonyms | TUBB2A; TUBB; TUBB2; dJ40E16.7; tubulin, beta 2A class Iia; tubulin beta-2A chain; class IIa beta-tubulin; tubulin beta class Iia; tubulin, beta polypeptide 2 | 
| Gene ID | 7280 | 
| mRNA Refseq | NM_001069 | 
| Protein Refseq | NP_001060 | 
| MIM | 615101 | 
| UniProt ID | Q13885 | 
| Chromosome Location | 6p25 | 
| Pathway | Chaperonin-mediated protein folding; Formation of tubulin folding intermediates by CCT/TriC; Metabolism of proteins | 
| Function | GTP binding; GTPase activity; structural constituent of cytoskeleton | 
| ◆ Recombinant Proteins | ||
| TUBB2A-1062C | Recombinant Cynomolgus TUBB2A Protein, His-tagged | +Inquiry | 
| TUBB2A-9760M | Recombinant Mouse TUBB2A Protein, His (Fc)-Avi-tagged | +Inquiry | 
| TUBB2A-6361R | Recombinant Rat TUBB2A Protein | +Inquiry | 
| TUBB2A-105H | Recombinant Human TUBB2A, GST-tagged | +Inquiry | 
| TUBB2A-31630TH | Recombinant Human TUBB2A, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| TUBB2A-651HCL | Recombinant Human TUBB2A 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All TUBB2A Products
Required fields are marked with *
My Review for All TUBB2A Products
Required fields are marked with *
  
        
    
      
            