Recombinant Human TUBB2A protein, His-SUMO-tagged
Cat.No. : | TUBB2A-3634H |
Product Overview : | Recombinant Human TUBB2A protein(Q13885)(1-445aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-445aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 65.9 kDa |
AA Sequence : | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TUBB2A tubulin, beta 2A class IIa [ Homo sapiens ] |
Official Symbol | TUBB2A |
Synonyms | TUBB2A; tubulin, beta 2A class IIa; TUBB, TUBB2, tubulin, beta 2 , tubulin, beta 2A , tubulin, beta polypeptide; tubulin beta-2A chain; class IIa beta tubulin; dJ40E16.7; class IIa beta-tubulin; tubulin, beta polypeptide 2; TUBB; TUBB2; |
Gene ID | 7280 |
mRNA Refseq | NM_001069 |
Protein Refseq | NP_001060 |
UniProt ID | Q13885 |
◆ Recombinant Proteins | ||
TUBB2A-4260H | Recombinant Human TUBB2A Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBB2A-6361R | Recombinant Rat TUBB2A Protein | +Inquiry |
TUBB2A-535HF | Recombinant Full Length Human TUBB2A Protein, GST-tagged | +Inquiry |
TUBB2A-17616M | Recombinant Mouse TUBB2A Protein | +Inquiry |
TUBB2A-805C | Recombinant Cynomolgus Monkey TUBB2A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBB2A-651HCL | Recombinant Human TUBB2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUBB2A Products
Required fields are marked with *
My Review for All TUBB2A Products
Required fields are marked with *