"CD5" Related Products

Expand
Expand

Recombinant Human CD5, StrepII-tagged

Cat.No.: CD5-235H
Product Overview: Purified human recombinant CD5 or T-cell surface glycoprotein protein (amino acids 25-372, 348 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.6 kDa. (Accession NP_055022.2; UniProt P06127)
Description: This product is the extracellular domain of CD5, a membrane glycoprotein that is thought to act as a receptor in regulating T-cell proliferation.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 25-372, 348 a.a.
AA Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTY TPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVV EFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEH CFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSV NSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: CD5 CD5 molecule [ Homo sapiens ]
Official Symbol: CD5
Synonyms: CD5; CD5 molecule; CD5 antigen (p56 62) , LEU1; T-cell surface glycoprotein CD5; T1; CD5 antigen (p56-62); lymphocyte antigen T1/Leu-1; LEU1;
Gene ID: 921
mRNA Refseq: NM_014207
Protein Refseq: NP_055022
MIM: 153340
UniProt ID: P06127
Chromosome Location: 11q13
Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; T Cell Receptor Signaling Pathway, organism-specific biosystem;
Function: glycoprotein binding; protein binding; receptor activity; scavenger receptor activity; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.