"NUP62" Related Products

Expand
Expand

Recombinant Human NUP62, GST-tagged

Cat.No.: NUP62-844H
Product Overview: Recombinant Human NUP62(423 a.a. - 522 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins and is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. Multiple transcript variants of this gene encode a single protein isoform.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.74 kDa
AA Sequence: LQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQR KVEEVTKVCEGRRKEQERSFRITFD
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: NUP62 nucleoporin 62kDa [ Homo sapiens (human) ]
Official Symbol: NUP62
Synonyms: NUP62; p62; IBSN; SNDI; nucleoporin 62kDa; nuclear pore glycoprotein p62; nucleoporin Nup62; 62 kDa nucleoporin
Gene ID: 23636
mRNA Refseq: NM_153719
Protein Refseq: NP_714941
MIM: 605815
UniProt ID: P37198
Chromosome Location: 19q13.33
Pathway: Antiviral mechanism by IFN-stimulated genes; Cytokine Signaling in Immune system; Export of Viral Ribonucleoproteins from Nucleus
Function: PTB domain binding; contributes_to nucleocytoplasmic transporter activity; receptor signaling complex scaffold activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.