Recombinant Human NUP62, GST-tagged
| Cat.No. : | NUP62-844H |
| Product Overview : | Recombinant Human NUP62(423 a.a. - 522 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins and is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. Multiple transcript variants of this gene encode a single protein isoform. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | LQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQR KVEEVTKVCEGRRKEQERSFRITFD |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NUP62 nucleoporin 62kDa [ Homo sapiens (human) ] |
| Official Symbol | NUP62 |
| Synonyms | NUP62; p62; IBSN; SNDI; nucleoporin 62kDa; nuclear pore glycoprotein p62; nucleoporin Nup62; 62 kDa nucleoporin |
| Gene ID | 23636 |
| mRNA Refseq | NM_153719 |
| Protein Refseq | NP_714941 |
| MIM | 605815 |
| UniProt ID | P37198 |
| Chromosome Location | 19q13.33 |
| Pathway | Antiviral mechanism by IFN-stimulated genes; Cytokine Signaling in Immune system; Export of Viral Ribonucleoproteins from Nucleus |
| Function | PTB domain binding; contributes_to nucleocytoplasmic transporter activity; receptor signaling complex scaffold activity |
| ◆ Recombinant Proteins | ||
| NUP62-769H | Recombinant Human NUP62 | +Inquiry |
| NUP62-147H | Recombinant Human NUP62 protein, T7-tagged | +Inquiry |
| NUP62-2958R | Recombinant Rhesus Macaque NUP62 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUP62-3140R | Recombinant Rhesus monkey NUP62 Protein, His-tagged | +Inquiry |
| NUP62-843H | Recombinant Human NUP62, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUP62-1233HCL | Recombinant Human NUP62 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUP62 Products
Required fields are marked with *
My Review for All NUP62 Products
Required fields are marked with *
