"MARS" Related Products

Expand
Expand
Expand

Recombinant Human MARS, GST-tagged

Cat.No.: MARS-21H
Product Overview: Recombinant Human MARS(801 a.a. - 899 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. The encoded protein is a component of the multi-tRNA synthetase complex and catalyzes the ligation of methionine to tRNA molecules.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.63 kDa
AA Sequence: LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAK LLDLKKQLAVAEGKPPEAPKGKKK
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MARS methionyl-tRNA synthetase [ Homo sapiens (human) ]
Official Symbol: MARS
Synonyms: MARS; MRS; METRS; MTRNS; SPG70; methionyl-tRNA synthetase; methionine--tRNA ligase, cytoplasmic; cytosolic methionyl-tRNA synthetase; NP_004981.2; EC 6.1.1.10
Gene ID: 4141
mRNA Refseq: NM_004990
Protein Refseq: NP_004981
MIM: 156560
UniProt ID: P56192
Chromosome Location: 12q13
Pathway: Aminoacyl-tRNA biosynthesis; Cytosolic tRNA aminoacylation; Selenocompound metabolism
Function: ATP binding; methionine-tRNA ligase activity; tRNA binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.