Recombinant Human MARS, GST-tagged

• Cat.No.: MARS-21H
• Product Overview: Recombinant Human MARS(801 a.a. - 899 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. The encoded protein is a component of the multi-tRNA synthetase complex and catalyzes the ligation of methionine to tRNA molecules.
• Molecular Mass: 36.63 kDa
• AA Sequence: LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAK LLDLKKQLAVAEGKPPEAPKGKKK
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MARS methionyl-tRNA synthetase [ Homo sapiens (human) ]
• Official Symbol: MARS
• Synonyms: MARS; MRS; METRS; MTRNS; SPG70; methionyl-tRNA synthetase; methionine--tRNA ligase, cytoplasmic; cytosolic methionyl-tRNA synthetase; NP_004981.2; EC 6.1.1.10
• Gene ID: 4141
• mRNA Refseq: NM_004990
• Protein Refseq: NP_004981
• MIM: 156560
• UniProt ID: P56192
• Chromosome Location: 12q13
• Pathway: Aminoacyl-tRNA biosynthesis; Cytosolic tRNA aminoacylation; Selenocompound metabolism
• Function: ATP binding; methionine-tRNA ligase activity; tRNA binding