Recombinant Human MARS, GST-tagged
Cat.No. : | MARS-21H |
Product Overview : | Recombinant Human MARS(801 a.a. - 899 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. The encoded protein is a component of the multi-tRNA synthetase complex and catalyzes the ligation of methionine to tRNA molecules. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAK LLDLKKQLAVAEGKPPEAPKGKKK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MARS methionyl-tRNA synthetase [ Homo sapiens (human) ] |
Official Symbol | MARS |
Synonyms | MARS; MRS; METRS; MTRNS; SPG70; methionyl-tRNA synthetase; methionine--tRNA ligase, cytoplasmic; cytosolic methionyl-tRNA synthetase; NP_004981.2; EC 6.1.1.10 |
Gene ID | 4141 |
mRNA Refseq | NM_004990 |
Protein Refseq | NP_004981 |
MIM | 156560 |
UniProt ID | P56192 |
Chromosome Location | 12q13 |
Pathway | Aminoacyl-tRNA biosynthesis; Cytosolic tRNA aminoacylation; Selenocompound metabolism |
Function | ATP binding; methionine-tRNA ligase activity; tRNA binding |
◆ Recombinant Proteins | ||
MARS-4595H | Recombinant Human MARS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MARS-5376M | Recombinant Mouse MARS Protein, His (Fc)-Avi-tagged | +Inquiry |
MARS-4633C | Recombinant Chicken MARS | +Inquiry |
MARS-29127TH | Recombinant Human MARS, His-tagged | +Inquiry |
MARS-2504R | Recombinant Rhesus Macaque MARS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARS-4463HCL | Recombinant Human MARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MARS Products
Required fields are marked with *
My Review for All MARS Products
Required fields are marked with *