Recombinant Human MARS, GST-tagged

Cat.No. : MARS-21H
Product Overview : Recombinant Human MARS(801 a.a. - 899 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. The encoded protein is a component of the multi-tRNA synthetase complex and catalyzes the ligation of methionine to tRNA molecules.
Molecular Mass : 36.63 kDa
AA Sequence : LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAK LLDLKKQLAVAEGKPPEAPKGKKK
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MARS methionyl-tRNA synthetase [ Homo sapiens (human) ]
Official Symbol MARS
Synonyms MARS; MRS; METRS; MTRNS; SPG70; methionyl-tRNA synthetase; methionine--tRNA ligase, cytoplasmic; cytosolic methionyl-tRNA synthetase; NP_004981.2; EC 6.1.1.10
Gene ID 4141
mRNA Refseq NM_004990
Protein Refseq NP_004981
MIM 156560
UniProt ID P56192
Chromosome Location 12q13
Pathway Aminoacyl-tRNA biosynthesis; Cytosolic tRNA aminoacylation; Selenocompound metabolism
Function ATP binding; methionine-tRNA ligase activity; tRNA binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MARS Products

Required fields are marked with *

My Review for All MARS Products

Required fields are marked with *

0
cart-icon