"SERPINB7" Related Products

Recombinant Human SERPINB7, GST-tagged

Cat.No.: SERPINB7-229H
Product Overview: Recombinant Human SERPINB7(227 a.a. - 327 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Serpin B7 is a protein that in humans is encoded by the SERPINB7 gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.85 kDa
AA Sequence: LELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFD ESKADLSGIASGGRLYISRMMHKSYI
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: SERPINB7 serpin peptidase inhibitor, clade B (ovalbumin), member 7 [ Homo sapiens (human) ]
Official Symbol: SERPINB7
Synonyms: SERPINB7; PPKN; TP55; MEGSIN; serpin peptidase inhibitor, clade B (ovalbumin), member 7; serpin B7; mesangium predominant gene, megsin; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 7
Gene ID: 8710
mRNA Refseq: NM_003784
Protein Refseq: NP_003775
MIM: 603357
UniProt ID: O75635
Chromosome Location: 18q21.33
Function: serine-type endopeptidase inhibitor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.