Recombinant Human SERPINB7, GST-tagged

• Cat.No.: SERPINB7-229H
• Product Overview: Recombinant Human SERPINB7(227 a.a. - 327 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Serpin B7 is a protein that in humans is encoded by the SERPINB7 gene.
• Molecular Mass: 36.85 kDa
• AA Sequence: LELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFD ESKADLSGIASGGRLYISRMMHKSYI
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SERPINB7 serpin peptidase inhibitor, clade B (ovalbumin), member 7 [ Homo sapiens (human) ]
• Official Symbol: SERPINB7
• Synonyms: SERPINB7; PPKN; TP55; MEGSIN; serpin peptidase inhibitor, clade B (ovalbumin), member 7; serpin B7; mesangium predominant gene, megsin; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 7
• Gene ID: 8710
• mRNA Refseq: NM_003784
• Protein Refseq: NP_003775
• MIM: 603357
• UniProt ID: O75635
• Chromosome Location: 18q21.33
• Function: serine-type endopeptidase inhibitor activity