Recombinant Human GNA11, GST-tagged GNA11-22H

Recombinant Human GNA11, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GNA11, GST-tagged

Recombinant Human GNA11, GST-tagged

GNA11 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GNA11-22H
Product Overview : Recombinant Human GNA11(1 a.a. - 359 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 68.5 kDa
AA Sequence : MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKRGF TKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPGIQECYDRRRE YQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTS IMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : GNA11 guanine nucleotide binding protein (G protein), alpha 11 (Gq class) [ Homo sapiens (human) ]
Official Symbol : GNA11
Synonyms : GNA11; FBH; FBH2; FHH2; HHC2; GNA-11; HYPOC2; guanine nucleotide binding protein (G protein), alpha 11 (Gq class); guanine nucleotide-binding protein subunit alpha-11; g alpha-11; G-protein subunit alpha-11; guanine nucleotide-binding protein G(y) subunit alpha
Gene ID : 2767
mRNA Refseq : NM_002067
Protein Refseq : NP_002058
MIM : 139313
UniProt ID : P29992
Chromosome Location : 19p13.3
Pathway : ADP signalling through P2Y purinoceptor 1; Calcium Regulation in the Cardiac Cell; Cholinergic synapse
Function : G-protein beta/gamma-subunit complex binding; G-protein coupled receptor binding; GTP binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy