Recombinant Human YBX1, GST-tagged

• Cat.No.: YBX1-4838H
• Product Overview: Recombinant Human YBX1(51 a.a. - 139 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 51-139 aa
• Description: Y box binding protein 1 also known as Y-box transcription factor or nuclease-sensitive element-binding protein 1 is a protein that in humans is encoded by the YBX1 gene.
• Molecular Mass: 35.53 kDa
• AA Sequence: DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANV TGPGGVPVQGSKYA
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: YBX1 Y box binding protein 1 [ Homo sapiens ]
• Official Symbol: YBX1
• Synonyms: YBX1; Y box binding protein 1; NSEP1, nuclease sensitive element binding protein 1; nuclease-sensitive element-binding protein 1; BP 8; CSDA2; CSDB; DBPB; MDR NF1; NSEP 1; YB 1; YB1; CBF-A; EFI-A; DNA-binding protein B; Y-box-binding protein 1; Y-box transcription factor; enhancer factor I subunit A; nuclease sensitive element binding protein 1; CCAAT-binding transcription factor I subunit A; major histocompatibility complex, class II, Y box-binding protein I; BP-8; YB-1; NSEP1; NSEP-1; MDR-NF1; MGC104858; MGC110976; MGC117250
• Gene ID: 4904
• mRNA Refseq: NM_004559
• Protein Refseq: NP_004550
• MIM: 154030
• UniProt ID: P67809
• Chromosome Location: 1p34
• Pathway: Gene Expression; Processing of Capped Intron-Containing Pre-mRNA; SIDS Susceptibility Pathways
• Function: DNA binding; RNA binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; single-stranded DNA binding