"YBX1" Related Products

Expand
Expand
Expand

Recombinant Human YBX1, GST-tagged

Cat.No.: YBX1-4838H
Product Overview: Recombinant Human YBX1(51 a.a. - 139 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Y box binding protein 1 also known as Y-box transcription factor or nuclease-sensitive element-binding protein 1 is a protein that in humans is encoded by the YBX1 gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 35.53 kDa
AA Sequence: DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANV TGPGGVPVQGSKYA
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: YBX1 Y box binding protein 1 [ Homo sapiens ]
Official Symbol: YBX1
Synonyms: YBX1; Y box binding protein 1; NSEP1, nuclease sensitive element binding protein 1; nuclease-sensitive element-binding protein 1; BP 8; CSDA2; CSDB; DBPB; MDR NF1; NSEP 1; YB 1; YB1; CBF-A; EFI-A; DNA-binding protein B; Y-box-binding protein 1; Y-box transcription factor; enhancer factor I subunit A; nuclease sensitive element binding protein 1; CCAAT-binding transcription factor I subunit A; major histocompatibility complex, class II, Y box-binding protein I; BP-8; YB-1; NSEP1; NSEP-1; MDR-NF1; MGC104858; MGC110976; MGC117250
Gene ID: 4904
mRNA Refseq: NM_004559
Protein Refseq: NP_004550
MIM: 154030
UniProt ID: P67809
Chromosome Location: 1p34
Pathway: Gene Expression; Processing of Capped Intron-Containing Pre-mRNA; SIDS Susceptibility Pathways
Function: DNA binding; RNA binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; single-stranded DNA binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.