"NPC1" Related Products

Expand
Expand

Recombinant Human NPC1, GST-tagged

Cat.No.: NPC1-29133TH
Product Overview: Recombinant Human NPC1(151 a.a. - 250 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a large protein that resides in the limiting membrane of endosomes and lysosomes and mediates intracellular cholesterol trafficking via binding of cholesterol to its N-terminal domain. It is predicted to have a cytoplasmic C-terminus, 13 transmembrane domains, and 3 large loops in the lumen of the endosome - the last loop being at the N-terminus. This protein transports low-density lipoproteins to late endosomal/lysosomal compartments where they are hydrolized and released as free cholesterol. Defects in this gene cause Niemann-Pick type C disease, a rare autosomal recessive neurodegenerative disorder characterized by over accumulation of cholesterol and glycosphingolipids in late endosomal/lysosomal compartments.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.63 kDa
AA Sequence: GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATK GCDESVDEVTAPCSCQDCSIVCGPK
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: NPC1 Niemann-Pick disease, type C1 [ Homo sapiens (human) ]
Official Symbol: NPC1
Synonyms: NPC1; NPC; Niemann-Pick disease, type C1; Niemann-Pick C1 protein
Gene ID: 4864
mRNA Refseq: NM_000271
Protein Refseq: NP_000262
MIM: 607623
UniProt ID: O15118
Chromosome Location: 18q11.2
Pathway: Lysosome
Function: cholesterol binding; hedgehog receptor activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.