Recombinant Human NPC1, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human NPC1, GST-tagged

Recombinant Human NPC1, GST-tagged

NPC1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : NPC1-29133TH
Product Overview : Recombinant Human NPC1(151 a.a. - 250 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : This gene encodes a large protein that resides in the limiting membrane of endosomes and lysosomes and mediates intracellular cholesterol trafficking via binding of cholesterol to its N-terminal domain. It is predicted to have a cytoplasmic C-terminus, 13 transmembrane domains, and 3 large loops in the lumen of the endosome - the last loop being at the N-terminus. This protein transports low-density lipoproteins to late endosomal/lysosomal compartments where they are hydrolized and released as free cholesterol. Defects in this gene cause Niemann-Pick type C disease, a rare autosomal recessive neurodegenerative disorder characterized by over accumulation of cholesterol and glycosphingolipids in late endosomal/lysosomal compartments.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 36.63 kDa
AA Sequence : GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATK GCDESVDEVTAPCSCQDCSIVCGPK
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : NPC1 Niemann-Pick disease, type C1 [ Homo sapiens (human) ]
Official Symbol : NPC1
Synonyms : NPC1; NPC; Niemann-Pick disease, type C1; Niemann-Pick C1 protein
Gene ID : 4864
mRNA Refseq : NM_000271
Protein Refseq : NP_000262
MIM : 607623
UniProt ID : O15118
Chromosome Location : 18q11.2
Pathway : Lysosome
Function : cholesterol binding; hedgehog receptor activity; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.