"PSRC1" Related Products

Recombinant Human PSRC1, GST-tagged

Cat.No.: PSRC1-39H
Product Overview: Recombinant Human PSRC1(1 a.a. - 333 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a proline-rich protein that is a target for regulation by the tumor suppressor protein p53. The encoded protein plays an important role in mitosis by recruiting and regulating microtubule depolymerases that destabalize microtubules. Alternatively spliced transcript variants encoding different isoforms have been described.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 62 kDa
AA Sequence: MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLE EILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRS NDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASPPTPIRSVLAPQP STSNSQRLPRPQGAAAKSSSQLPIPSAIPRPASRMPLTSRSVPPGRGALPPDSLSTRKGLPRPSTAGHRVRESGH KVPVSQRLNLPVMGATRSNLQPPRKVAVPGPTR
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: PSRC1 proline/serine-rich coiled-coil 1 [ Homo sapiens ]
Official Symbol: PSRC1
Synonyms: PSRC1; proline/serine-rich coiled-coil 1; proline/serine-rich coiled-coil protein 1; DDA3; differential display and activated by p53; DDA3; Differential display and activated by p53; FP3214; p53-regulated DDA3; Proline/serine-rich coiled-coil 1; proline/serine-rich coiled-coil protein 1; p53-regulated DDA3; FP3214
Gene ID: 84722
mRNA Refseq: NM_032636
Protein Refseq: NP_116025
MIM: 613126
UniProt ID: Q6PGN9
Chromosome Location: 1p13.3
Function: microtubule binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.