Recombinant Human PSRC1 protein, His-tagged
Cat.No. : | PSRC1-3139H |
Product Overview : | Recombinant Human PSRC1 protein(1-215 aa), fused to His tag, was expressed in E. coli. |
Availability | August 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-215 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASEET |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PSRC1 proline/serine-rich coiled-coil 1 [ Homo sapiens ] |
Official Symbol | PSRC1 |
Synonyms | PSRC1; proline/serine-rich coiled-coil 1; proline/serine-rich coiled-coil protein 1; DDA3; differential display and activated by p53; p53-regulated DDA3; FP3214; MGC1780; |
Gene ID | 84722 |
mRNA Refseq | NM_001005290 |
Protein Refseq | NP_001005290 |
MIM | 613126 |
UniProt ID | Q6PGN9 |
◆ Recombinant Proteins | ||
PSRC1-3139H | Recombinant Human PSRC1 protein, His-tagged | +Inquiry |
PSRC1-3500R | Recombinant Rhesus Macaque PSRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSRC1-4794R | Recombinant Rat PSRC1 Protein | +Inquiry |
PSRC1-39H | Recombinant Human PSRC1, GST-tagged | +Inquiry |
PSRC1-4453R | Recombinant Rat PSRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSRC1-447HCL | Recombinant Human PSRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSRC1 Products
Required fields are marked with *
My Review for All PSRC1 Products
Required fields are marked with *