"TTN" Related Products

Expand

Recombinant Human TTN, GST-tagged

Cat.No.: TTN-26H
Product Overview: Recombinant Human TTN(1 a.a. - 305 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a large abundant protein of striated muscle. The product of this gene is divided into two regions, a N-terminal I-band and a C-terminal A-band. The I-band, which is the elastic part of the molecule, contains two regions of tandem immunoglobulin domains on either side of a PEVK region that is rich in proline, glutamate, valine and lysine. The A-band, which is thought to act as a protein-ruler, contains a mixture of immunoglobulin and fibronectin repeats, and possesses kinase activity. An N-terminal Z-disc region and a C-terminal M-line region bind to the Z-line and M-line of the sarcomere, respectively, so that a single titin molecule spans half the length of a sarcomere. Titin also contains binding sites for muscle associated proteins so it serves as an adhesion template for the assembly of contractile machinery in muscle cells. It has also been identified as a structural protein for chromosomes. Alternative splicing of this gene results in multiple transcript variants. Considerable variability exists in the I-band, the M-line and the Z-disc regions of titin. Variability in the I-band region contributes to the differences in elasticity of different titin isoforms and, therefore, to the differences in elasticity of different muscle types. Mutations in this gene are associated with familial hypertrophic cardiomyopathy 9, and autoantibodies to titin are produced in patients with the autoimmune disease scleroderma.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 59.2 kDa
AA Sequence: MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANS GRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDF QISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKI EAHFDARSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT PSPVR
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: TTN titin [ Homo sapiens]
Official Symbol: TTN
Synonyms: TTN; titin; TMD;CMH9; CMD1G; CMPD4; EOMFC; FLJ32040; FLJ26020; FLJ26409; FLJ34413; FLJ39564;FLJ43066; HMERF; MYLK5; LGMD2J; MPRM; DKFZp451N061; connectin; OTTHUMP00000233809;OTTHUMP00000233810; rhabdomyosarcoma antigen MU-RMS-40.14; cardiomyopathy,dilated 1G (autosomal dominant); EC 2.7.11.1
Gene ID: 7273
mRNA Refseq: NM_003319
Protein Refseq: NP_003310
MIM: 188840
UniProt ID: Q8WZ42
Chromosome Location: 2q31
Pathway: Dilated cardiomyopathy;Hemostasis; Hypertrophic cardiomyopathy (HCM); Muscle contraction; Plateletactivation; Platelet degranulation; Response to elevated platelet cytosolicCa2+;
Function: ATP binding; actinfilament binding; alpha-actinin binding; calcium ion binding; calmodulinbinding; identical protein binding; muscle alpha-actinin binding; nucleicacid binding; nucleotide binding; protein binding; protein self-association;protein serine/threonine kinase activity; protein tyrosine kinase activity;structural constituent of muscle; telethonin binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.