"BAX" Related Products

Expand
Expand

Recombinant Human BAX, His-tagged

Cat.No.: BAX-6976H
Product Overview: Recombinant Human Apoptosis Regulator BAX/BAX is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln171) of Human BAX fused with a 6His tag at both the N-terminus and C-terminus.
Source: E. coli
Species: Human
Tag : His
Form: Lyophilized from sterile 20mM PB,150mM NaCl, 2mM EDTA, 5% Threhalose, pH7.4.
Protein length: Met1-Gln171
AA Sequence: MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH
Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method.
Purity: >95% as determined by SDS-PAGE.
Stability: Samples are stable for up to twelve months from date of receipt at -70ºC.
Storage: Store it under sterile conditions at -20ºC~-70ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4ºC before opening to recover the entire contents.
Gene Name: BAX BCL2-associated X protein [ Homo sapiens ]
Official Symbol: BAX
Synonyms: BAX; BCL2-associated X protein; apoptosis regulator BAX; BCL2L4; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega;
Gene ID: 581
mRNA Refseq: NM_004324
Protein Refseq: NP_004315
MIM: 600040
UniProt ID: Q07812

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.