"OARD1" Related Products

Recombinant Human OARD1, GST-tagged

Cat.No.: OARD1-107H
Product Overview: Recombinant Human OARD1(1 a.a. - 152 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 43.12 kDa
AA Sequence: MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDG RYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVY TL
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: OARD1 O-acyl-ADP-ribose deacylase 1 [ Homo sapiens (human) ]
Official Symbol: OARD1
Synonyms: OARD1; TARG1; C6orf130; dJ34B21.3; O-acyl-ADP-ribose deacylase 1; O-acetyl-ADP-ribose deacetylase 1; O-acetyl-ADP-ribose deacetylase C6orf130; terminal ADP-ribose protein glycohydrolase 1
Gene ID: 221443
mRNA Refseq: NM_145063
Protein Refseq: NP_659500
MIM: 614393
UniProt ID: Q9Y530
Chromosome Location: 6p21.1
Function: deacetylase activity; protein binding; purine nucleoside binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.