"MCM3" Related Products

Expand
Expand
Expand

Recombinant Human MCM3, GST-tagged

Cat.No.: MCM3-23H
Product Overview: Recombinant Human MCM3( 699 a.a. - 808 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 37.84 kDa
AA Sequence: AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESIN RDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MCM3 minichromosome maintenance complex component 3 [ Homo sapiens ]
Official Symbol: MCM3
Synonyms: MCM3; minichromosome maintenance complex component 3; HCC5; P1.h; RLFB; P1-MCM3; DNA replication licensing factor MCM3; p102; RLF subunit beta; hRlf beta subunit; DNA replication factor MCM3; cervical cancer proto-oncogene 5; minichromosome maintenance deficient 3; replication licensing factor, beta subunit; replication licensing factor, beta subunit; DNA polymerase alpha holoenzyme-associated protein P1; NP_001257401.1; EC 3.6.4.12; NP_002379.3
Gene ID: 4172
mRNA Refseq: NM_002388
Protein Refseq: NP_002379
MIM: 602693
UniProt ID: P25205
Chromosome Location: 6p12
Pathway: Activation of ATR in response to replication sress; DNA Replication; E2F transcription factor network; G2/M Checkpoints
Function: ATP binding; DNA binding; DNA helicase activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.