Recombinant Human MCM3, GST-tagged

• Cat.No.: MCM3-23H
• Product Overview: Recombinant Human MCM3( 699 a.a. - 808 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 37.84 kDa
• AA Sequence: AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESIN RDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MCM3 minichromosome maintenance complex component 3 [ Homo sapiens ]
• Official Symbol: MCM3
• Synonyms: MCM3; minichromosome maintenance complex component 3; HCC5; P1.h; RLFB; P1-MCM3; DNA replication licensing factor MCM3; p102; RLF subunit beta; hRlf beta subunit; DNA replication factor MCM3; cervical cancer proto-oncogene 5; minichromosome maintenance deficient 3; replication licensing factor, beta subunit; replication licensing factor, beta subunit; DNA polymerase alpha holoenzyme-associated protein P1; NP_001257401.1; EC 3.6.4.12; NP_002379.3
• Gene ID: 4172
• mRNA Refseq: NM_002388
• Protein Refseq: NP_002379
• MIM: 602693
• UniProt ID: P25205
• Chromosome Location: 6p12
• Pathway: Activation of ATR in response to replication sress; DNA Replication; E2F transcription factor network; G2/M Checkpoints
• Function: ATP binding; DNA binding; DNA helicase activity; protein binding