Recombinant Human ARNT, GST-tagged ARNT-20H

Recombinant Human ARNT, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ARNT, GST-tagged

Recombinant Human ARNT, GST-tagged

ARNT Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ARNT-20H
Product Overview : Recombinant Human ARNT(1 a.a. - 789 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 113 kDa
AA Sequence : MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFA RSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTST DGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQL STSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTF VDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPY SDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHS QVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSS FSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPA QQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Publication :
Gene Name : ARNT aryl hydrocarbon receptor nuclear translocator [ Homo sapiens (human) ]
Official Symbol : ARNT
Synonyms : ARNT; aryl hydrocarbon receptor nuclear translocator; bHLHe2; HIF 1beta; dioxin receptor, nuclear translocator; class E basic helix-loop-helix protein 2; hypoxia-inducible factor 1, beta subunit; HIF1B; TANGO; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta
Gene ID : 405
mRNA Refseq : NM_001668
Protein Refseq : NP_001659
MIM : 126110
UniProt ID : P27540
Chromosome Location : 1q21
Pathway : AhR pathway; Cellular response to hypoxia; Chemical carcinogenesis
Function : contributes_to RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; aryl hydrocarbon receptor activity; aryl hydrocarbon receptor binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy