"CD14" Related Products

Expand
Expand
Expand

Recombinant Human CD14, His-tagged

Cat.No. : CD14-28H
Product Overview : CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
Description : The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein.
Source : HEK293 cells.
Species : Human
Tag : His
Form : Sterile Filtered White lyophilized (freeze-dried) powder. CD14 was lyophilized from a 0.2 μM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.
AA Sequence : TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRL TVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAAL AAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELP EVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH
Purity : Greater than 95% as determined by SDS-PAGE.
Stability : Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Reconstitution : It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Gene Name : CD14 CD14 molecule [ Homo sapiens (human) ]
Official Symbol : CD14
Synonyms : CD14; CD14 molecule; CD14 antigen; monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein
Gene ID : 929
mRNA Refseq : NM_000591
Protein Refseq : NP_000582
MIM : 158120
UniProt ID : P08571
Chromosome Location : 5q31.1
Pathway : Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon; Hematopoietic cell lineage; IKK complex recruitment mediated by RIP1
Function : lipopolysaccharide binding; lipoteichoic acid binding; peptidoglycan receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.