Recombinant Human CD14, His-tagged

Cat.No. : CD14-28H
Product Overview : CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 20-352 a.a.
Description : The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein.
Form : Sterile Filtered White lyophilized (freeze-dried) powder. CD14 was lyophilized from a 0.2 μM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.
AA Sequence : TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRL TVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAAL AAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELP EVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH
Purity : Greater than 95% as determined by SDS-PAGE.
Stability : Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Reconstitution : It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Gene Name CD14 CD14 molecule [ Homo sapiens (human) ]
Official Symbol CD14
Synonyms CD14; CD14 molecule; CD14 antigen; monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein
Gene ID 929
mRNA Refseq NM_000591
Protein Refseq NP_000582
MIM 158120
UniProt ID P08571
Chromosome Location 5q31.1
Pathway Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon; Hematopoietic cell lineage; IKK complex recruitment mediated by RIP1
Function lipopolysaccharide binding; lipoteichoic acid binding; peptidoglycan receptor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD14 Products

Required fields are marked with *

My Review for All CD14 Products

Required fields are marked with *

0
cart-icon