"RORC" Related Products

Expand
Expand

Recombinant Human RORC Protein, GST-tagged

Cat.No.: RORC-114H
Product Overview: Recombinant Human RORC was expressed in insect cells with N-terminal GST tag.
Source: Insect cells
Species: Human
Tag : GST
Form: Liquid
Molecular Mass: ~57 kDa as estimated in SDS-PAGE under reducing conditions.
AA Sequence: YGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Purity: > 90% determined by SDS-PAGE
Storage: Immediately store at -80 centigrade. Avoid freeze-thaw cycles. While working, please keep sample on ice.
Storage Buffer: 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 0.5 mM EDTA, 3 mM Dithiothreitol, 10 mM reduced glutathione, 20% glycerol.
Gene Name: RORC RAR-related orphan receptor C [ Homo sapiens ]
Official Symbol: RORC
Synonyms: RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
Gene ID: 6097
mRNA Refseq: NM_001001523
Protein Refseq: NP_001001523
MIM: 602943
UniProt ID: P51449

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.