"RORC" Related Products

Expand
Expand

Recombinant Human RORC Protein, GST-tagged

Cat.No.: RORC-114H
Product Overview: Recombinant Human RORC was expressed in insect cells with N-terminal GST tag.
Source: Insect cells
Species: Human
Tag : GST
Form: Liquid
Molecular Mass: ~57 kDa as estimated in SDS-PAGE under reducing conditions.
AA Sequence: YGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Purity: > 90% determined by SDS-PAGE
Storage: Immediately store at -80 centigrade. Avoid freeze-thaw cycles. While working, please keep sample on ice.
Storage Buffer: 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 0.5 mM EDTA, 3 mM Dithiothreitol, 10 mM reduced glutathione, 20% glycerol.
Gene Name: RORC RAR-related orphan receptor C [ Homo sapiens ]
Official Symbol: RORC
Synonyms: RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
Gene ID: 6097
mRNA Refseq: NM_001001523
Protein Refseq: NP_001001523
MIM: 602943
UniProt ID: P51449

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.