Recombinant Human RORC Protein, GST-tagged
| Cat.No. : | RORC-02H |
| Product Overview : | Recombinant Human RORC fused with GST tag was produced in Insect cells. |
| Availability | August 20, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | GST |
| Description : | The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : | 50 mM Tris-HCl pH 8.0, 200 mM NaCl |
| Molecular Mass : | ~55kDa as estimated by SDS-PAGE under reducing condition. |
| AA sequence : | PYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWE MWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADN RTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQ EKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVV QAAFPPLYKELFS |
| Purity : | > 92% as determined by SDS-PAGE |
| Storage : | Please prepare aliquots and store at -20 ~ -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.25 mg/ml |
| Publications : |
| Gene Name | RORC RAR-related orphan receptor C [ Homo sapiens ] |
| Official Symbol | RORC |
| Synonyms | RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539; |
| Gene ID | 6097 |
| mRNA Refseq | NM_001001523 |
| Protein Refseq | NP_001001523 |
| MIM | 602943 |
| UniProt ID | P51449 |
| ◆ Recombinant Proteins | ||
| RORC-15H | Recombinant Human RORC protein, His/Flag-tagged | +Inquiry |
| RORC-6192H | Recombinant Human RORC Protein (Leu241-Phe486), N-His tagged | +Inquiry |
| RORC-5893H | Recombinant Human RORC protein, His-tagged | +Inquiry |
| Rorc-2027M | Recombinant Mouse Rorc Protein, His-tagged | +Inquiry |
| RORC-1357H | Recombinant Human RORC Protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RORC-2244HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
| RORC-2245HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RORC Products
Required fields are marked with *
My Review for All RORC Products
Required fields are marked with *



