Recombinant Human RORC Protein, His-SUMO-tagged
| Cat.No. : | RORC-1357H |
| Product Overview : | Recombinant Human RORC Protein (1-518aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-518 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 74.2 kDa |
| AA Sequence : | MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | RORC RAR-related orphan receptor C [ Homo sapiens ] |
| Official Symbol | RORC |
| Synonyms | RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539 |
| Gene ID | 6097 |
| mRNA Refseq | NM_001001523 |
| Protein Refseq | NP_001001523 |
| MIM | 602943 |
| UniProt ID | P51449 |
| ◆ Recombinant Proteins | ||
| RORC-4002H | Recombinant Human RORC Protein, His (Fc)-Avi-tagged | +Inquiry |
| RORC-02H | Recombinant Human RORC Protein, GST-tagged | +Inquiry |
| RORC-7708M | Recombinant Mouse RORC Protein, His (Fc)-Avi-tagged | +Inquiry |
| RORC-1357H | Recombinant Human RORC Protein, His-SUMO-tagged | +Inquiry |
| RORC-17H | Recombinant Human RORC protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RORC-2245HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
| RORC-2244HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RORC Products
Required fields are marked with *
My Review for All RORC Products
Required fields are marked with *


