Recombinant Human HSD17B2, GST-tagged HSD17B2-206H

Recombinant Human HSD17B2, GST-tagged

PRODUCTS

Home / Products / Recombinant Human HSD17B2, GST-tagged

Recombinant Human HSD17B2, GST-tagged

HSD17B2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : HSD17B2-206H
Product Overview : Recombinant Human HSD17B2(1 a.a. - 387 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : Estradiol 17-beta-dehydrogenase 2 is an enzyme that in humans is encoded by the HSD17B2 gene.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 68.31 kDa
AA Sequence : MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQ ELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYS KVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAP MERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPR ALRMPNYKKKAT
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : HSD17B2 hydroxysteroid (17-beta) dehydrogenase 2 [ Homo sapiens (human) ]
Official Symbol : HSD17B2
Synonyms : HSD17B2; hydroxysteroid (17-beta) dehydrogenase 2; estradiol 17-beta-dehydrogenase 2; HSD17; SDR9C2; short chain dehydrogenase/reductase family 9C; member 2; 17 beta HSD 2; 20 alpha HSD; 20 alpha hydroxysteroid dehydrogenase; E2DH; Microsomal 17 beta hydroxysteroid dehydrogenase; Testosterone 17 beta dehydrogenase; E2DH; 20-alpha-HSD; 17-beta-HSD 2; OTTHUMP00000174979; testosterone 17-beta-dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase type 2; microsomal 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 9C, member 2; EDH17B2
Gene ID : 3294
mRNA Refseq : NM_002153
Protein Refseq : NP_002144
MIM : 109685
UniProt ID : P37059
Chromosome Location : 16q24.1-q24.2
Pathway : Metabolic pathways; Ovarian steroidogenesis; Steroid Biosynthesis
Function : 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity; estradiol 17-beta-dehydrogenase activity; testosterone dehydrogenase (NAD+) activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy