"HSD17B2" Related Products

Expand

Recombinant Human HSD17B2, GST-tagged

Cat.No.: HSD17B2-206H
Product Overview: Recombinant Human HSD17B2(1 a.a. - 387 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Estradiol 17-beta-dehydrogenase 2 is an enzyme that in humans is encoded by the HSD17B2 gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 68.31 kDa
AA Sequence: MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQ ELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYS KVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAP MERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPR ALRMPNYKKKAT
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: HSD17B2 hydroxysteroid (17-beta) dehydrogenase 2 [ Homo sapiens (human) ]
Official Symbol: HSD17B2
Synonyms: HSD17B2; hydroxysteroid (17-beta) dehydrogenase 2; estradiol 17-beta-dehydrogenase 2; HSD17; SDR9C2; short chain dehydrogenase/reductase family 9C; member 2; 17 beta HSD 2; 20 alpha HSD; 20 alpha hydroxysteroid dehydrogenase; E2DH; Microsomal 17 beta hydroxysteroid dehydrogenase; Testosterone 17 beta dehydrogenase; E2DH; 20-alpha-HSD; 17-beta-HSD 2; OTTHUMP00000174979; testosterone 17-beta-dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase type 2; microsomal 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 9C, member 2; EDH17B2
Gene ID: 3294
mRNA Refseq: NM_002153
Protein Refseq: NP_002144
MIM: 109685
UniProt ID: P37059
Chromosome Location: 16q24.1-q24.2
Pathway: Metabolic pathways; Ovarian steroidogenesis; Steroid Biosynthesis
Function: 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity; estradiol 17-beta-dehydrogenase activity; testosterone dehydrogenase (NAD+) activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.