"UGT2B7" Related Products

Recombinant Human UGT2B7, GST-tagged

Cat.No. : UGT2B7-209H
Product Overview : Recombinant Human UGT2B7(1 a.a. - 529 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : The protein encoded by this gene belongs to the UDP-glycosyltransferase (UGT) family. UGTs serve a major role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This protein is localized in the microsome membrane, and has unique specificity for 3,4-catechol estrogens and estriol, suggesting that it may play an important role in regulating the level and activity of these potent estrogen metabolites.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 84.59 kDa
AA Sequence : MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIE IYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFA DAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFE IFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHG GANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQH DQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKK GKND
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : UGT2B7 UDP glucuronosyltransferase 2 family, polypeptide B7 [ Homo sapiens (human) ]
Official Symbol : UGT2B7
Synonyms : UGT2B7; UDP glucuronosyltransferase 2 family, polypeptide B7; UDP glycosyltransferase 2 family, polypeptide B7; UDP-glucuronosyltransferase 2B7; UGT2B9; 3 4 catechol estrogen specific; UDP glucuronosyltransferase 2 family polypeptide B7; UDP glucuronosyltransferase 2B7; UDP glucuronyltransferase family 2 beta 7; UDP glycosyltransferase 2 family polypeptide B7; UDPGT; UDPGTh 2; UDPGTh2; UGT2B9; UGTB2B9; UDPGTh-2; UDPGT 2B7; 3,4-catechol estrogen specific; UDP glucuronosyltransferase 2B7; UDP-glucuronosyltransferase 2B9; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronyltransferase, family 2, beta-7; UDPGTH2; UDPGT2B7; UDPGT 2B9
Gene ID : 7364
mRNA Refseq : NM_001074
Protein Refseq : NP_001065
MIM : 600068
UniProt ID : P16662
Chromosome Location : 4q13
Pathway : Ascorbate and aldarate metabolism; Chemical carcinogenesis; Codeine and morphine metabolism
Function : glucuronosyltransferase activity; NOT retinoic acid binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.