"UGT2B7" Related Products

Recombinant Human UGT2B7, GST-tagged

Cat.No.: UGT2B7-209H
Product Overview: Recombinant Human UGT2B7(1 a.a. - 529 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene belongs to the UDP-glycosyltransferase (UGT) family. UGTs serve a major role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This protein is localized in the microsome membrane, and has unique specificity for 3,4-catechol estrogens and estriol, suggesting that it may play an important role in regulating the level and activity of these potent estrogen metabolites.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 84.59 kDa
AA Sequence: MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIE IYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFA DAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFE IFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHG GANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQH DQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKK GKND
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: UGT2B7 UDP glucuronosyltransferase 2 family, polypeptide B7 [ Homo sapiens (human) ]
Official Symbol: UGT2B7
Synonyms: UGT2B7; UDP glucuronosyltransferase 2 family, polypeptide B7; UDP glycosyltransferase 2 family, polypeptide B7; UDP-glucuronosyltransferase 2B7; UGT2B9; 3 4 catechol estrogen specific; UDP glucuronosyltransferase 2 family polypeptide B7; UDP glucuronosyltransferase 2B7; UDP glucuronyltransferase family 2 beta 7; UDP glycosyltransferase 2 family polypeptide B7; UDPGT; UDPGTh 2; UDPGTh2; UGT2B9; UGTB2B9; UDPGTh-2; UDPGT 2B7; 3,4-catechol estrogen specific; UDP glucuronosyltransferase 2B7; UDP-glucuronosyltransferase 2B9; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronyltransferase, family 2, beta-7; UDPGTH2; UDPGT2B7; UDPGT 2B9
Gene ID: 7364
mRNA Refseq: NM_001074
Protein Refseq: NP_001065
MIM: 600068
UniProt ID: P16662
Chromosome Location: 4q13
Pathway: Ascorbate and aldarate metabolism; Chemical carcinogenesis; Codeine and morphine metabolism
Function: glucuronosyltransferase activity; NOT retinoic acid binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.