"TJP1" Related Products

Expand

Recombinant Human TJP1, GST-tagged

Cat.No.: TJP1-240H
Product Overview: Recombinant Human TJP1(338 a.a. - 638 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Alternative splicing of this gene results in multiple transcript variants.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 58.74 kDa
AA Sequence: SNGSLRSRDEERISKPGAVSTPVKHADDHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVL PNSTHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEA VLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWL AIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAY E
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: TJP1 tight junction protein 1 [ Homo sapiens (human) ]
Official Symbol: TJP1
Synonyms: TJP1; tight junction protein 1 (zona occludens 1); ZO-1; MGC133289; DKFZp686M05161; zonula occludens 1 protein; tight junction protein ZO-1; 3` partial; zona occludens 1; Zonula occludens protein 1; Tight junction protein 1; OTTHUMP00000174520; zonula occludens 1 protein
Gene ID: 7082
mRNA Refseq: NM_003257
Protein Refseq: NP_003248
MIM: 601009
UniProt ID: Q07157
Chromosome Location: 15q13
Pathway: Apoptotic cleavage of cell adhesion proteins; E-cadherin signaling in the nascent adherens junction; Gap junction
Function: calmodulin binding; protein C-terminus binding; protein domain specific binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.