Recombinant Human TJP1, GST-tagged
| Cat.No. : | TJP1-240H |
| Product Overview : | Recombinant Human TJP1(338 a.a. - 638 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Alternative splicing of this gene results in multiple transcript variants. |
| Molecular Mass : | 58.74 kDa |
| AA Sequence : | SNGSLRSRDEERISKPGAVSTPVKHADDHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVL PNSTHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEA VLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWL AIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAY E |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TJP1 tight junction protein 1 [ Homo sapiens (human) ] |
| Official Symbol | TJP1 |
| Synonyms | TJP1; tight junction protein 1 (zona occludens 1); ZO-1; MGC133289; DKFZp686M05161; zonula occludens 1 protein; tight junction protein ZO-1; 3` partial; zona occludens 1; Zonula occludens protein 1; Tight junction protein 1; OTTHUMP00000174520; zonula occludens 1 protein |
| Gene ID | 7082 |
| mRNA Refseq | NM_003257 |
| Protein Refseq | NP_003248 |
| MIM | 601009 |
| UniProt ID | Q07157 |
| Chromosome Location | 15q13 |
| Pathway | Apoptotic cleavage of cell adhesion proteins; E-cadherin signaling in the nascent adherens junction; Gap junction |
| Function | calmodulin binding; protein C-terminus binding; protein domain specific binding |
| ◆ Recombinant Proteins | ||
| TJP1-3189H | Recombinant Human TJP1 Protein (Met1-Val190), His tagged | +Inquiry |
| TJP1-015H | Recombinant Human tight junction protein 1 Protein, His&Flag&StrepII tagged | +Inquiry |
| TJP1-1114H | Recombinant Human TJP1 Protein, MYC/DDK-tagged | +Inquiry |
| TJP1-833D | Recombinant Dog TJP1 Protein (1633-1769 aa), His-tagged | +Inquiry |
| TJP1-2197H | Recombinant Human TJP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TJP1 Products
Required fields are marked with *
My Review for All TJP1 Products
Required fields are marked with *
