Recombinant Human TJP1, GST-tagged

Cat.No. : TJP1-240H
Product Overview : Recombinant Human TJP1(338 a.a. - 638 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Alternative splicing of this gene results in multiple transcript variants.
Molecular Mass : 58.74 kDa
AA Sequence : SNGSLRSRDEERISKPGAVSTPVKHADDHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVL PNSTHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEA VLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWL AIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAY E
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TJP1 tight junction protein 1 [ Homo sapiens (human) ]
Official Symbol TJP1
Synonyms TJP1; tight junction protein 1 (zona occludens 1); ZO-1; MGC133289; DKFZp686M05161; zonula occludens 1 protein; tight junction protein ZO-1; 3` partial; zona occludens 1; Zonula occludens protein 1; Tight junction protein 1; OTTHUMP00000174520; zonula occludens 1 protein
Gene ID 7082
mRNA Refseq NM_003257
Protein Refseq NP_003248
MIM 601009
UniProt ID Q07157
Chromosome Location 15q13
Pathway Apoptotic cleavage of cell adhesion proteins; E-cadherin signaling in the nascent adherens junction; Gap junction
Function calmodulin binding; protein C-terminus binding; protein domain specific binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TJP1 Products

Required fields are marked with *

My Review for All TJP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon