Recombinant Human APOA2, His-tagged

Cat.No. : APOA2-95H
Product Overview : Recombinant Human Apolipoprotein A-II/ApoA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Gln100) of Human APOA2 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : 24-100 a.a.
Description : This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
AA Sequence : QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLS YFVELGTQPATQVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping : The product is shipped at ambient temperature.
Gene Name APOA2 apolipoprotein A-II [ Homo sapiens (human) ]
Official Symbol APOA2
Synonyms APOA2; apolipoprotein A-II; apoAII; Apo-AII; ApoA-II; apolipoprotein A-II; apolipoprotein A2; OTTHUMP00000032244; Apolipoprotein A-II; Apolipoprotein A2
Gene ID 336
mRNA Refseq NM_001643
Protein Refseq NP_001634
MIM 107670
UniProt ID P02652
Chromosome Location 1q23.3
Pathway Chylomicron-mediated lipid transport; Fatty acid; Lipid digestion; Lipoprotein metabolism; Metabolism of lipids and lipoproteins; PPAR signaling pathway; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha);
Function apolipoprotein receptor binding; cholesterol binding; contributes to cholesterol transporter activity; high-density lipoprotein particle receptor binding; lipase inhibitor activity; lipid binding; lipid transporter activity; phosphatidylcholine binding; phosphatidylcholine-sterol O-acyltransferase activator activity; phospholipid binding; protein binding; protein heterodimerization activity; protein homodimerization activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOA2 Products

Required fields are marked with *

My Review for All APOA2 Products

Required fields are marked with *

0
cart-icon