Recombinant Human APOA2, His-tagged APOA2-95H

Recombinant Human APOA2, His-tagged

PRODUCTS

Home / Products / Recombinant Human APOA2, His-tagged

Recombinant Human APOA2, His-tagged

APOA2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : APOA2-95H
Product Overview : Recombinant Human Apolipoprotein A-II/ApoA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Gln100) of Human APOA2 fused with a polyhistidine tag at the C-terminus.
Description : This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
Source : Human cells
Species : Human
Tag : His
AA Sequence : QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLS YFVELGTQPATQVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping : The product is shipped at ambient temperature.
Gene Name : APOA2 apolipoprotein A-II [ Homo sapiens (human) ]
Official Symbol : APOA2
Synonyms : APOA2; apolipoprotein A-II; apoAII; Apo-AII; ApoA-II; apolipoprotein A-II; apolipoprotein A2; OTTHUMP00000032244; Apolipoprotein A-II; Apolipoprotein A2
Gene ID : 336
mRNA Refseq : NM_001643
Protein Refseq : NP_001634
MIM : 107670
UniProt ID : P02652
Chromosome Location : 1q23.3
Pathway : Chylomicron-mediated lipid transport; Fatty acid; Lipid digestion; Lipoprotein metabolism; Metabolism of lipids and lipoproteins; PPAR signaling pathway; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha);
Function : apolipoprotein receptor binding; cholesterol binding; contributes to cholesterol transporter activity; high-density lipoprotein particle receptor binding; lipase inhibitor activity; lipid binding; lipid transporter activity; phosphatidylcholine binding; phosphatidylcholine-sterol O-acyltransferase activator activity; phospholipid binding; protein binding; protein heterodimerization activity; protein homodimerization activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy