Recombinant Human APOA2, His-tagged

• Cat.No.: APOA2-95H
• Product Overview: Recombinant Human Apolipoprotein A-II/ApoA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Gln100) of Human APOA2 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: 24-100 a.a.
• Description: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
• AA Sequence: QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLS YFVELGTQPATQVDHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: APOA2 apolipoprotein A-II [ Homo sapiens (human) ]
• Official Symbol: APOA2
• Synonyms: APOA2; apolipoprotein A-II; apoAII; Apo-AII; ApoA-II; apolipoprotein A-II; apolipoprotein A2; OTTHUMP00000032244; Apolipoprotein A-II; Apolipoprotein A2
• Gene ID: 336
• mRNA Refseq: NM_001643
• Protein Refseq: NP_001634
• MIM: 107670
• UniProt ID: P02652
• Chromosome Location: 1q23.3
• Pathway: Chylomicron-mediated lipid transport; Fatty acid; Lipid digestion; Lipoprotein metabolism; Metabolism of lipids and lipoproteins; PPAR signaling pathway; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
• Function: apolipoprotein receptor binding; cholesterol binding; contributes to cholesterol transporter activity; high-density lipoprotein particle receptor binding; lipase inhibitor activity; lipid binding; lipid transporter activity; phosphatidylcholine binding; phosphatidylcholine-sterol O-acyltransferase activator activity; phospholipid binding; protein binding; protein heterodimerization activity; protein homodimerization activity