"APOA2" Related Products

Expand
Expand

Recombinant Human APOA2, His-tagged

Cat.No.: APOA2-95H
Product Overview: Recombinant Human Apolipoprotein A-II/ApoA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Gln100) of Human APOA2 fused with a polyhistidine tag at the C-terminus.
Description: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
Source: Human cells
Species: Human
Tag: His
AA Sequence: QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLS YFVELGTQPATQVDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping: The product is shipped at ambient temperature.
Gene Name: APOA2 apolipoprotein A-II [ Homo sapiens (human) ]
Official Symbol: APOA2
Synonyms: APOA2; apolipoprotein A-II; apoAII; Apo-AII; ApoA-II; apolipoprotein A-II; apolipoprotein A2; OTTHUMP00000032244; Apolipoprotein A-II; Apolipoprotein A2
Gene ID: 336
mRNA Refseq: NM_001643
Protein Refseq: NP_001634
MIM: 107670
UniProt ID: P02652
Chromosome Location: 1q23.3
Pathway: Chylomicron-mediated lipid transport; Fatty acid; Lipid digestion; Lipoprotein metabolism; Metabolism of lipids and lipoproteins; PPAR signaling pathway; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha);
Function: apolipoprotein receptor binding; cholesterol binding; contributes to cholesterol transporter activity; high-density lipoprotein particle receptor binding; lipase inhibitor activity; lipid binding; lipid transporter activity; phosphatidylcholine binding; phosphatidylcholine-sterol O-acyltransferase activator activity; phospholipid binding; protein binding; protein heterodimerization activity; protein homodimerization activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.