Recombinant Zebrafish TRADD Protein, His tagged
| Cat.No. : | TRADD-9147Z |
| Product Overview : | Recombinant Zebrafish TRADD Protein with His tag was expressed in HEK293. |
| Availability | December 26, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Zebrafish |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-293 aa |
| Description : | Predicted to enable transmembrane receptor protein tyrosine kinase adaptor activity. Acts upstream of or within positive regulation of apoptotic process. Predicted to be located in cytoplasm; cytoskeleton; and nucleus. Predicted to be part of tumor necrosis factor receptor superfamily complex. Orthologous to human TRADD (TNFRSF1A associated via death domain). |
| AASequence : | MDSIDTKRLNDSNASDRALSGCAVLFLGCSSLEHNFLSLYKDERGKFSVFKVIKLTLSDSVGGLEGYEILKLHDADPYLGVELKFMAMPPCQRFLESYACGSLTQFLSQHASRLLALPDGVEIETQLKAGVHTLDHSLQDIEICLDHIRQSQPVRLRDDEVTQLEQQLQNSYGPPSQPPQELPRNCFLFQKRVFDDRPLTPADQQRFAAHVGRDWKRVGRALQKNCRALKGPAIDNLAYEYEREGLYEQAYQLLGRFIQSEGRSAKLSRLISALEETKMTSMAEIMLGIQPRDHHHHHHHHHH |
| Molecular Mass : | 35 kDa |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 80% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Lyophilized from PBS, pH7.4, 0.1% SKL, 5% Trehalose, 5% Mannitol |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.165 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
| Gene ID | 58130 |
| Gene Name | tradd tnfrsf1a-associated via death domain [ Danio rerio (zebrafish) ] |
| Official Symbol | 58130 |
| Synonyms | tradd; tnfrsf1a-associated via death domain; zehn0873; wu:fc59e02; zgc:103556; hm:zehn0873; tumor necrosis factor receptor type 1-associated DEATH domain protein; TNFR1-associated DEATH domain protein; TNFRSF1A-associated via death domain protein |
| mRNA Refseq | NM_131607 |
| Official Symbol 2 | tradd |
| Gene ID 2 | 58130 |
| Gene Name 2 | tradd tnfrsf1a-associated via death domain [ Danio rerio (zebrafish) ] |
| mRNA Refseq 2 | NM_131607 |
| Protein Refseq 2 | NP_571682 |
| UniProt ID 2 | Q9I9N5 |
| ◆ Recombinant Proteins | ||
| TRADD-3383H | Recombinant Human TRADD protein, His-tagged | +Inquiry |
| TRADD-29977TH | Recombinant Human TRADD, His-tagged | +Inquiry |
| TRADD-6657H | Recombinant Human TRADD Protein (Met61-Leu297), N-His tagged | +Inquiry |
| TRADD-3384H | Recombinant Human TRADD protein, His-tagged | +Inquiry |
| Tradd-1415M | Recombinant Mouse Tradd protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRADD-826HCL | Recombinant Human TRADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRADD Products
Required fields are marked with *
My Review for All TRADD Products
Required fields are marked with *
