Recombinant Human TRADD, His-tagged
| Cat.No. : | TRADD-29977TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-150 of Human TRADD with an N terminal His tag; Predicted MWt 17 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-150 a.a. |
| Description : | The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway. |
| Conjugation : | HIS |
| Tissue specificity : | Found in all examined tissues. |
| Form : | Lyophilised:Reconstitute with 113 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVA VYRALQAALAALLAQDPSPVPTLPGPPFPSQGRGHRRL KRVGGSVRGLRAARAPLLPEQWESRLVEAEDLRPLALL CPAGRLPRRLVCPGHTPPFLCFEVPLFCQPSFGA |
| Sequence Similarities : | Contains 1 death domain. |
| Full Length : | Full L. |
| Gene Name | TRADD TNFRSF1A-associated via death domain [ Homo sapiens ] |
| Official Symbol | TRADD |
| Synonyms | TRADD; TNFRSF1A-associated via death domain; tumor necrosis factor receptor type 1-associated DEATH domain protein; Hs.89862; |
| Gene ID | 8717 |
| mRNA Refseq | NM_003789 |
| Protein Refseq | NP_003780 |
| MIM | 603500 |
| Uniprot ID | Q15628 |
| Chromosome Location | 16q22 |
| Pathway | Activation of Pro-Caspase 8, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; |
| Function | binding, bridging; death domain binding; identical protein binding; kinase binding; protein binding; |
| ◆ Recombinant Proteins | ||
| TRADD-4420H | Recombinant Human TRADD protein, GST-tagged | +Inquiry |
| Tradd-1415M | Recombinant Mouse Tradd protein, His & T7-tagged | +Inquiry |
| TRADD-9147Z | Recombinant Zebrafish TRADD Protein, His tagged | +Inquiry |
| Tradd-1416R | Recombinant Rat Tradd protein, His & T7-tagged | +Inquiry |
| TRADD-6657H | Recombinant Human TRADD Protein (Met61-Leu297), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRADD-826HCL | Recombinant Human TRADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRADD Products
Required fields are marked with *
My Review for All TRADD Products
Required fields are marked with *



