Recombinant Human TRADD, His-tagged

Cat.No. : TRADD-29977TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-150 of Human TRADD with an N terminal His tag; Predicted MWt 17 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-150 a.a.
Description : The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway.
Conjugation : HIS
Tissue specificity : Found in all examined tissues.
Form : Lyophilised:Reconstitute with 113 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVA VYRALQAALAALLAQDPSPVPTLPGPPFPSQGRGHRRL KRVGGSVRGLRAARAPLLPEQWESRLVEAEDLRPLALL CPAGRLPRRLVCPGHTPPFLCFEVPLFCQPSFGA
Sequence Similarities : Contains 1 death domain.
Full Length : Full L.
Gene Name TRADD TNFRSF1A-associated via death domain [ Homo sapiens ]
Official Symbol TRADD
Synonyms TRADD; TNFRSF1A-associated via death domain; tumor necrosis factor receptor type 1-associated DEATH domain protein; Hs.89862;
Gene ID 8717
mRNA Refseq NM_003789
Protein Refseq NP_003780
MIM 603500
Uniprot ID Q15628
Chromosome Location 16q22
Pathway Activation of Pro-Caspase 8, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem;
Function binding, bridging; death domain binding; identical protein binding; kinase binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRADD Products

Required fields are marked with *

My Review for All TRADD Products

Required fields are marked with *

0
cart-icon